PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG029776t1
Common NameTCM_029776
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WOX
Protein Properties Length: 377aa    MW: 41113 Da    PI: 8.8737
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG029776t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.4e-1855115257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Thecc1EG029776t1  55 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 115
                       89*****************99*************************************995 PP

2Wus_type_Homeobox112.52.2e-3654117265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++kq
   Thecc1EG029776t1  54 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHKQ 117
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.82E-1250119IPR009057Homeodomain-like
PROSITE profilePS5007110.51151116IPR001356Homeobox domain
SMARTSM003892.6E-953120IPR001356Homeobox domain
CDDcd000867.41E-954117No hitNo description
Gene3DG3DSA:1.10.10.602.5E-754123IPR009057Homeodomain-like
PfamPF000461.9E-1555115IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTH HQWQPDINPS LMSSGCHRAP YTSVTGCEER SPEPKPRWNP  60
KPEQIRILEA IFNSGMVNPP RDEIRKIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKQRNL  120
QNSKQQSQQT PPMTNITTIT APSSSSSSSE KSSPKGANKS TLSMSSPNVI DVSNSPTASV  180
NQAYFHQPQN EFLNEPFFFP VQQAAAGTGF TQGFVFSELN NMVQVPEQPV GPCTSLLLSE  240
ILNNGASKKA HEEKMKMQLQ LNYPGSTAPS THTISPLTAS TTATITVPSN INHVQGVGES  300
GVVGPGGAAR SAVFINDVAF EVAVGPFNVR EAFGDDAVLI HSSGQPVLTN EWGVTVQPLQ  360
HGGFYYLVRS SIPFSV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025495.10.0Homeobox-3, putative
SwissprotQ6X7J43e-92WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A061GG540.0A0A061GG54_THECC; Homeobox-3, putative
STRINGVIT_10s0003g00560.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-91homeobox-3
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]